PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P08320_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 449aa    MW: 50935.6 Da    PI: 5.3996
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P08320_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS73.44.1e-231842841104
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++lL++cAe v+ gd + a +lL+++++++sp gd+++Rla++f+ +L+arla+++s++y+++ +++ s   +s+ l+ +k +  ++
  GSMUA_Achr5P08320_001 184 LRTLLVHCAESVAIGDRRSAGELLKQIRQHSSPFGDANERLAHCFADGLEARLAGTGSQIYHSIVAKRIS---TSDILKGYKCYMRAC 268
                            6789************************************************************999999...899************ PP

                   GRAS  89 PilkfshltaNqaIle 104
                            P+ k+++l  N++Il+
  GSMUA_Achr5P08320_001 269 PFKKIAYLYSNRTILN 284
                            **************97 PP

2GRAS78.21.5e-24282374128219
                   GRAS 128 LlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrl 213
                            +l+ Las+p+gpp+lRiTg+++p++g   +e++ etg+rLa++A+++g+pfef++ +a++++++++e+L+++++E+l+Vn+ +q ++l
  GSMUA_Achr5P08320_001 282 ILNRLASQPGGPPRLRITGIDKPSPGfrPTERIDETGQRLADYARRFGIPFEFHA-IATKWDTIRTEDLNIDKDEVLVVNSLFQFKSL 368
                            7899*********************9*****************************.7******************************* PP

                   GRAS 214 ldesvs 219
                             de++s
  GSMUA_Achr5P08320_001 369 IDETGS 374
                            999875 PP

3GRAS543.3e-17366444295374
                   GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            ++++   g+er+er et+++W+ r  +aGFk++pl++++ k ak  l+ +++d + ++ + ++l++gWk+r L ++SaWr
  GSMUA_Achr5P08320_001 366 KSLIDETGSERVERPETYKQWQVRNIRAGFKQLPLNSDIIKMAKEKLKAYHKD-FVLDVDGQWLLQGWKGRILQAFSAWR 444
                            5688999********************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098519.645158449IPR005202Transcription factor GRAS
PfamPF035145.2E-22282374IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MDSLVAPEFS PDMVLGFISQ ILMEEDMDDK FDVFHEDLAL LAAEKPFYEI LGETFPPLPD  60
QNSGPSAESP DGSSIIESLS NPLSDNDLVI QSTPAWQFQK GLEEARRFLP SNWKLAEINA  120
DEKHESPIRE PRGRKTHHDD DLDLQEGRSN KQSALSTEEP LRPDILDDVL LCGKKQSMKD  180
VVDLRTLLVH CAESVAIGDR RSAGELLKQI RQHSSPFGDA NERLAHCFAD GLEARLAGTG  240
SQIYHSIVAK RISTSDILKG YKCYMRACPF KKIAYLYSNR TILNRLASQP GGPPRLRITG  300
IDKPSPGFRP TERIDETGQR LADYARRFGI PFEFHAIATK WDTIRTEDLN IDKDEVLVVN  360
SLFQFKSLID ETGSERVERP ETYKQWQVRN IRAGFKQLPL NSDIIKMAKE KLKAYHKDFV  420
LDVDGQWLLQ GWKGRILQAF SAWRSDDYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-191883958251GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009399986.10.0PREDICTED: scarecrow-like protein 14
SwissprotO809331e-91SCL9_ARATH; Scarecrow-like protein 9
TrEMBLM0SWR10.0M0SWR1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P08320_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.17e-93GRAS family protein